Allergen

CAD87731.1

Accession CAD87731.1
Species Lens culinaris
Common Name Lentil
Description 7S globulin/ vicilin-like protein
IUIS Name Len c 1
Gi 0029539111
Length 415
Year Adopted 2007
Sequence >CAD87731.1 Allergen Len c 1; 7S globulin/ vicilin-like protein [Lens culinaris]
SRSDQENPFIFKSNRFQTIYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFL
PQYTDADFILVVLSGKAVLTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVL
DLAIPVNNPGQLESFLLSGTQNQPSFLSGFNKSILEAAFNTDYEEIEKVLLEDQEQEPQH
RRSLRDRRQEINKENVIVKVSREQIKELSKNAKSSSKKSVSSESEPFNLRSRNPIYSNKF
GKFFEITPEKNPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGYFELVGQRN
ENQREENDDEEEQEEETSTQVQRYRAKLSPGDVFVVPAGHPVAINASSDLNLIGFGINAK
NNQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRLLTNQKQSHFANAQPLQIE
Parent Accession