Powered by FoodRisk.org

Allergen

CAL07989.1

Accession CAL07989.1
Species Platanus x acerifolia
Common Name London plane tree
Description lipid transfer protein [Platanus x acerifolia]
Gi 0110224778
Length 118
Year Adopted 2016
Sequence >accession|CAL07989.1|Allergen lipid transfer protein [Platanus x acerifolia]
MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTFLRSGGAVAPACCNGVKA
LNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKCGVNLPYKISPTIDCSKVK