Allergen

CAL59819.1

Accession CAL59819.1
External DB Link NCBI Protein
Species Vespula germanica
Common Name wasp
Description phospholipase A1
IUIS Name
Length 323
Year Adopted 2008
Sequence >CAL59819.1 phospholipase A1 [Vespula germanica]
VITIWPKKGFSIYWNIPTHFCHNFGVYFKELKQFNIKYNSMNNFRGETISLFYDPGNFPS
MVLLKNGTYEIRNEGVPQKGNLTIHLEQFTKELDEIYPKKIAGGIGVIHFHNWRPIFRRN
VDNLKINKDISIDLVRKEHPKWDKSMIEKEASNRFETSAKIFMEKTLKLAKEIRKKTEWG
YHGYPHCLSGSTDKPSFDCDALSMSENDKMSWLFNNQNVLLPSIYLKNVLKPDEKIHLVQ
ERLKEAIRISKNLKHLPKVLPYWWYTYQDKESIFLTEADVKNTFKEILTNGADGIIIWGV
SYELTDRKRCEKLKEYLMKILGP
Parent Accession

Related Articles

Pubmed Authors Title Journal
8828537 King,T.P.; Lu,G.; Gonzalez,M.; Qian,N.; Soldatova,L. Yellow jacket venom allergens, hyaluronidase and phospholipase: sequence similarity and antigenic cross-reactivity with their hornet and wasp homologs and possible implications for clinical allergy J. Allergy Clin. Immunol. 98 (3), 588-600 (1996)
12403934 Binder M; Fierlbeck G; King T; Valent P; Buhring HJ Individual hymenoptera venom compounds induce upregulation of the basophil activation marker ectonucleotide pyrophosphatase/phosphodiesterase 3 (CD203c) in sensitized patients. Int Arch Allergy Immunol. 2002 Oct;129(2):160-8
16218950 Kolarich D; Leonard R; Hemmer W; Altmann F The N-glycans of yellow jacket venom hyaluronidases and the protein sequence of its major isoform in Vespula vulgaris. FEBS J. 2005 Oct;272(20):5182-90
15005742 Hemmer W; Focke M; Kolarich D; Dalik I; Gotz M; Jarisch R Identification by immunoblot of venom glycoproteins displaying immunoglobulin E-binding N-glycans as cross-reactive allergens in honeybee and yellow jacket venom. Clin Exp Allergy. 2004 Mar;34(3):460-9
16699186 Skov LK; Seppälä U; Coen JJ; Crickmore N; King TP; Monsalve R; Kastrup JS; Spangfort MD; Gajhede M Structure of recombinant Ves v 2 at 2.0 Angstrom resolution: structural analysis of an allergenic hyaluronidase from wasp venom. Acta Crystallogr D Biol Crystallogr. 2006 Jun;62(Pt 6):595-604