Powered by FoodRisk.org

Allergen

CAM31908.1

Accession CAM31908.1
Species Actinidia chinensis
Common Name Kiwi
Description bet v 1 related allergen [Actinidia chinensis]
Gi 0281552896
Length 159
Year Adopted 2011
Sequence >accession|CAM31908.1|Putative bet v 1 related allergen [Actinidia chinensis]
MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG
EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI
YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPDYC