Powered by FoodRisk.org

Allergen

CAM31908.1

Accession CAM31908.1
Species Actinidia chinensis
Common Name Kiwi
Description pathogenesis related protein / PR-10 / Bet v 1-like protein
IUIS Name Act c 8
Gi 0281552896
Length 159
Year Adopted 2011
Sequence >CAM31908.1 Allergen Act c 8; pathogenesis related protein / PR-10 / Bet v 1-like protein [Actinidia chinensis]
MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG
EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI
YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPDYC
Parent Accession