Allergen

CAQ72968.1

Accession CAQ72968.1
External DB Link NCBI Protein
Species Sebastes marinus
Common Name ocean perch (red fish)
Description calcium-binding protein, parvalbumin
IUIS Name Seb m 1
Length 109
Year Adopted 2011
Sequence >CAQ72968.1 Seb m 1; calcium-binding protein, parvalbumin [Sebastes marinus]
MALAASLNAADITAALAACSGVDTFKHKDFFGKVGLSAKSADDIKNAFKVIDQDKSGFIE
EEELKLFLQNFSATARALTEAETTAFLKAGDSDGDGMIGMDEFAAMVKG
Parent Accession

Related Articles

Pubmed Authors Title Journal
20559001 Kuehn A; Scheuermann T; Hilger C; Hentges F Important Variations in Parvalbumin Content in Common Fish Species: A Factor Possibly Contributing to Variable Allergenicity. Int Arch Allergy Immunol. 2010 Jun 17;153(4):359-366
21999209 Lee PW; Nordlee JA; Koppelman SJ; Baumert JL; Taylor SL Evaluation and comparison of the species-specificity of 3 antiparvalbumin IgG antibodies. J Agric Food Chem. 2011 Dec 14;59(23):12309-16
N/A: See Journal Lee PW, Nordlee JA, Koppelman SJ, Baumert JL, Taylor SL CONFIDENTIAL: Comparison of IgE binding to 25 species of fish extracts CONFIDENTIAL: part of dissertation
N/A: See Journal Kuehn A Kuehn parvalbumin fish poster Rome ISMA conference in Rome 2007