Allergen

COMPARE00290

Accession COMPARE00290
External DB Link
Species Gallus gallus
Common Name chicken
Description beta-enolase, partial from P07322.3
IUIS Name Gal d 9
Length 79
Year Adopted 2022
Sequence >COMPARE00290 Gal d 9; beta-enolase, partial from P07322.3 [Gallus gallus]
KAGAAEKGVPLYRHIADLAGNTELILPVPAFNVINGGSHAGNKLAMQEFMVLPVGAASFH
DAMRVGAEVYHSLKGVIKA
Parent Accession P07322.3

Related Sequences

Peptide sequences mapped to Parent Accession

To zoom in, left-click and drag the mouse pointer to the right: left-click on the desired start point, hold the mouse button, move the mouse to the desired end point (to the right) and let go. Zoom back out by right-clicking.