Allergen

COMPARE00314

Accession COMPARE00314
Species Vespa velutina
Common Name Asian hornet
Description unknown function, antigen 5, partial
IUIS Name Vesp v 5
Gi
Length 100
Year Adopted 2022
Sequence >COMPARE00314 Allergen Vesp v 5; unknown function, antigen 5, partial [Vespa velutina]
NTAKYLVGQNIAEQSTTAASFEPVSNMVKMWSDEVKDYQYGSSKNKLNDVGHYTQMVWAK
TKEIGCGNIKYIENGWHHHYLVCNYGPAGNIGNEPIYEKK
Parent Accession P0DMB9