Allergen

COMPARE00328

Accession COMPARE00328
Species Prunus dulcis
Common Name almond
Description cysteine-rich anti-microbial protein, partial
IUIS Name Pru du 8
Gi
Length 60
Year Adopted 2022
Sequence >COMPARE00328 Allergen Pru du 8; cysteine-rich anti-microbial protein, partial [Prunus dulcis]
RCMQVEQQGVFQGQQQQQQQQVEQQCRQHCQSERDPMRQQECQEDCVGQMMQQEYEQQCR
Parent Accession A0A314YX39