Powered by FoodRisk.org

COMPARE Database

COMPARE009

Accession COMPARE009
Species Dermatophagoides pteronyssinus
Common Name European House Dust Mite
Description Putative Der p 23
Gi
Length 90
Year Adopted 2019
Sequence >accession|COMPARE009|Putative Der p 23 [Dermatophagoides pteronyssinus]
MKFNIIIVFISLAILVHSSYAANDNDDDPTTTVHPTTTEQPDDKFECPSRFGYFADPKDP
HKRYICSNWEAVHKDCPGNTRWNEDEETCT