Powered by FoodRisk.org

Allergen

COMPARE073

Accession COMPARE073
Species Ascaris lumbricoides
Common Name common roundworm
Description Allergen Asc l 13; glutathione S-transferase, partial
Gi
Length 68
Year Adopted 2020MS
Sequence >COMPARE073 Allergen Asc l 13; glutathione S-transferase, partial [Ascaris lumbricoides]
RLIFHQAGVKFEDNRLKREDWPALKPKTPFGQPLLEVDGEVLAQSAAIYR