Powered by FoodRisk.org

Allergen

COMPARE150

Accession COMPARE150
Species Ulocladium botrytis
Common Name Fungus
Description Alt a 1 homologue
IUIS Name
Gi
Length 115
Year Adopted 2020H_MS
Sequence >COMPARE150 Alt a 1 homologue [Ulocladium botrytis]
MQFTTIASLFAAAGLAAAAPLESRQDNASCPVTTKGDYVWKISEFYGRKPEGTYYNSLGF
NIKATNGGTLDFTCSAQADKLEGHKWYSCGENSFMDFSFDSDRSGLLLKQKVSDE
Parent Accession