Allergen

COMPARE153

Accession COMPARE153
Species Amaranthus retroflexus
Common Name rough pigweed
Description calcium-binding protein, polcalcin, partial
IUIS Name
Gi
Length 86
Year Adopted 2020
Sequence >COMPARE153 calcium-binding protein, polcalcin, partial [Amaranthus retroflexus]
MAAEDTPQDIADRERIFKRKETNGDGKISSSELGDALKTLGSVTPDEVRRMMAEIDTDGD
GFISFDEFTDFARANRGLVKDVSKIF
Parent Accession