Powered by FoodRisk.org

Allergen

COMPARE240

Accession COMPARE240
Species Malus domestica
Common Name Apple
Description pathogenesis related protein / PR-10 / Bet v 1-like protein
IUIS Name Mal d 1
Gi
Length 159
Year Adopted 2021
Sequence >COMPARE240 Allergen Mal d 1; pathogenesis related protein / PR-10 / Bet v 1-like protein [Malus domestica]
MGVFTYESEFTSVIPPARLYNAFVLDADNLIPKIAPQAVKSTEILEGD
GGVGTIKKINFGEGSTYSYVKHRIDGLDKDNFVYKYSVIEGDAISETI
EKISYETKLVASDSGSIIKSTSHYHTKGDVEIKEEHVKAGKEKASHLF
KLIENYLLEHHDAYN
Parent Accession