Powered by FoodRisk.org

Allergen

COMPARE243

Accession COMPARE243
Species Malus domestica
Common Name Apple
Description pathogenesis related protein / PR-10 / Bet v 1-like protein
IUIS Name Mal d 1
Gi
Length 163
Year Adopted 2021
Sequence >COMPARE243 Allergen Mal d 1; pathogenesis related protein / PR-10 / Bet v 1-like protein [Malus domestica]
MGVTKISQKFVTQVTPQRMFNALILDAHNICPKLMFSSIKSIEFLSG
SGEVGTIKQINFTEASPMKYAKHRIDALDKEALSCTYTFIESDATDH
LLDKLEYITYDVKFEGYGRGGCICHLTSTYKAKDDIQIKEEDIELGK
DRAIGMYEVLEAYLMAHPRAYV
Parent Accession