Powered by FoodRisk.org

Allergen

COMPARE245

Accession COMPARE245
Species Malus domestica
Common Name Apple
Description thaumatin like protein
IUIS Name Mal d 2
Gi
Length 248
Year Adopted 2021
Sequence >COMPARE245 Allergen Mal d 2; thaumatin like protein [Malus domestica]
MTMMKSQVASLLGLTLAILFFSGAHAAKITFTNNCPNTVWPGTLTGDQKPQ
LSLTGFELASKASRSVDAPSPWSGRFWGRTRCSTDAAGKFTCETADCGSGQ
VACNGAGAVPPATLVEITIAANGGQDYYDVSLVDGFNLPMSVAPQGGTGEC
KPSSCPANVNKVCPAPLQVKAADGSVISCKSACLAFGDSKYCCTPPNNTPE
TCPPTEYSEIFEKQCPQAYSYAYDDKNSTFTCSGGPDYVITFCP
Parent Accession NA
Notes This record replaces Accession: Q9FSG7.1 from previous COMPARE versions (duplicate; COMPARE245 is 2 aa longer than Q9FSG7.1