Powered by FoodRisk.org

Allergen

COMPARE246

Accession COMPARE246
Species Malus domestica
Common Name Apple
Description profilin
IUIS Name Mal d 4
Gi
Length 131
Year Adopted 2021
Sequence >COMPARE246 Allergen Mal d 4; profilin [Malus domestica]
MSWQQYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSASFPAFKPEEIA
AILKDFDQPGTLAPTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKK
TSQALLIGIYDEPVTPGQCNIVVERLGDYLIEQGL
Parent Accession NA