Allergen

D2T2K2

Accession D2T2K2
Species Triticum aestivum
Common Name wheat
Description lipid transfer protein
IUIS Name Tri a 14
Gi
Length 92
Year Adopted 2022
Sequence >D2T2K2 Allergen Tri a 14; lipid transfer protein [Triticum aestivum]
ISCSQVDSTLMPCLQYVQQGGSPARGCCTGIQNLLAEANNSPDRRTICGCLKNVANGASG
GPYITRAAALPSKCNVALPYKISPSVDCNTVH
Parent Accession