Powered by FoodRisk.org

Allergen

F5B8W0.1

Accession F5B8W0.1
Species Lupinus angustifolius
Common Name Narrowleaf Lupine
Description Conglutin beta 2; Lup an 1
Gi 0980951548
Length 603
Year Adopted 2017
Sequence >accession|F5B8W0.1|Conglutin beta 2; Lup an 1 [Lupinus angustifolius]
MANMRVKFPTLVLLLGIVFLMAVSIGIAYGEKNAIKNHERPQEREQEERDPRQQPRPRHQ
EEQEREHGREEERNREPSRGRSESEESREEEREQRREPSRGREQEQQPQHGRREEEEEWQ
PRRQRPQSRREEREQEQGSSSSSGRQSGYERREQREEREQQQEQDSRSESRRQRNPYYFS
YERFQTLYKNRNGQIRVLERFDQRTNRLENLQNYRIVEFQSKPNTLILPKHSDADYILVV
LNGRATITIVNPDKRQAYNLEHGDALRLPAGTTSYILNPDDNQNLRVVKLAIPINNPGNF
YDFYPSSTKDQQSYFNGFSRNTLEATFNTRYEEIQRIILGNEDGQEDEEQSRGQEQSHQD
QGVIVRVSKEQIQELRKHAQSSSGKGKPSESGPFNLRSDEPIYSNKFGNFYEITPDRNPQ
AQDLDISLTFIEINEGGLLLPHYNSKAIFVVVVDEGEGNYELVGIRDQERQQDEQEQEEV
RRYNAKLSEGDIFVIPAGHPISINASSNLRLLGFGINADENQRNFLAGSEDNVIRQLDKE
VKQLTFPGSVEDVERLIKNQQQSYFANAQPQQQQQREKEGRRGRRGLSFPFRSLFTKLLS
TIM