Powered by FoodRisk.org

Allergen

F5B8W1.1

Accession F5B8W1.1
Species Lupinus angustifolius
Common Name Narrowleaf Lupine
Description Conglutin beta 3; Lup an 1
Gi 0980951550
Length 580
Year Adopted 2017
Sequence >accession|F5B8W1.1|Conglutin beta 3; Lup an 1 [Lupinus angustifolius]
MAKMRVRFPTLVLLLGIVFLMAVSIGIAYGEKNVLKNHERPQEREQEERDPRQQPRPHHQ
EEQEREHRRESEESQEEEREQRREPRREREQEQQPQHGRREEEEEWQPRRQRPQSRREER
EQEQGSSSSSRRQSGYERREQREEREQEQEQGSRSDSRRQRNPYYFSSERFQTLYRNRNG
QIRVLERFDQRTNRLENLQNYRIVEFQSKPNTLILPKHSDADYILVVLNGSATITIVNPD
KRQSYNLENGDALRLPAGTTSYILNPDDNQNLRVVKLAIPINNPGNFYDFYPSSSKDQQS
YFSGFSKNTLEATFNTRYEEIQSILLGNEDEQEDDEQWHGQEQSHQDEGVIVRVSKEQVQ
ELRKYAQSSSRKGKPYESGPFNLRSNKPIYSNKFGNFYEITPDRNPQAQDLDISLTFIEI
NEGALLLPHYNSKAIFVVVVDEGEGNYELVGIRDQQRQQDEQEVRRYSARLSEGDIFVIP
AGHPISINASSNLRLLGFGINADENQRNFLAGSEDNVIRQLDREVKGLIFPGSAEDVERL
IKNQQQSYFANAQPQQQQQREREGRHGRRGHISSILSTLY