Powered by FoodRisk.org

Allergen

F5B8W3.1

Accession F5B8W3.1
Species Lupinus angustifolius
Common Name Narrowleaf Lupine
Description Conglutin beta 5; Lup an 1
Gi 0980951561
Length 637
Year Adopted 2017
Sequence >accession|F5B8W3.1|Conglutin beta 5; Lup an 1 [Lupinus angustifolius]
MAKMRVRFPMLVLLLGVVFLLAVSIGIAYGEKDVIKNPERPEERQEEERDPRQPPRSRQQ
EEQEREHRREKERDREPSRGRSESKQSQEEERERRKEHDREREQEQQPQYGRRHEEEEKG
EEEEEGQARRQRPQRRREEREQEQGSSSESRRQSGDERRHRHEKREQREEREQEQGSSSG
RQSDYGRRQRHEGREQREEREQEQGSSSESHRLRNPYYFSSERFQTRYKNKNGQIRVLER
FDQRTNRLENLQNYRIVEFQSRPNTLILPKHSDADYILVVLNGRATITIVNPDKRQAYNL
EYGDALRLPAGTTSYILNPDDNQDLRVVKLAIPINNPGKFYDFYPSRTKDQQSYFSGFSK
NTLEATFNTHYEEIQRILLGYEDEQEDEEQRREQEQSHQDEGVIVRVSKEQIQELRKHAQ
SSSRKGKPSESGPFNLRSNEPIYSNKFGNFYEITPDRNPQVQDLDISLIFTEISEGALLL
PHYNSKAIFVIVVDEGEGNYELVGIRNQQRQQDEQEVEEVRSYNARLSEGDILVIPAGHP
LSINASSNLRLLGFGINADENQRNFLAGSEDNVIRQLDREVKELIFPGSAEDVERLIRNQ
QQSYFANAQPQQQQQQREKEGRRGRRGPISSILSALY