Allergen

GFG40850.1

Accession GFG40850.1
Species Coptotermes formosanus
Common Name formosan subterranean termite
Description arginine kinase
IUIS Name
Gi
Length 356
Year Adopted 2022
Sequence >GFG40850.1 arginine kinase [Coptotermes formosanus]
MVDQAVLDKLEAGYAKLAASDSKSLLKKFLTKEVFDNLKTKKTPSFGSSLLDVIQSGLEN
HDSGVGIYAPDAEAYSVFADLFDPIIEDYHGGFKKTDKHPPKDWGDVDTLGNLDPAGEYI
ISTRVRCGRSLEGYPFNPCLTEAQYKEMEEKVSSTLSGLEGELKGQFYPLTGMTKEVQQK
LIDDHFLFKEGDRFLQAANACRFWPTGRGIYHNDAKTFLVWCNEEDHLRIISMQMGGDLG
QVYRRLVTAVNDIEKRIPFSHDDRLGFLTFCPTNLGTTVRASVHIKVPKLAADRAKLEEV
AGKYNLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYEAVKEMHDGIAELIKLESSL
Parent Accession