Powered by FoodRisk.org

Allergen

KEY78748.1

Accession KEY78748.1
Species Aspergillus fumigatus var. RP-2014
Common Name Fungus
Description allergen Asp F7 [Aspergillus fumigatus var. RP-2014]
Gi 0666431137
Length 270
Year Adopted 2016
Sequence >accession|KEY78748.1|Putative allergen Asp F7 [Aspergillus fumigatus var. RP-2014]
MAPIFKSLALVSALFAAISSAAPVNLDKREVDVVWTTVTTVVWTTIDVTTTIYPTPQAPT
PPVVESTPTPTPSAAPEQAEPIETSTQPETTKSQPTQPSVATFIPVAAAAAAADSAAPVP
EEPAPQPATTAAPSTSTTTQAAPSAPPAANSGSTEKAASSGYSGPCSKGSPCVGQLTYYD
TATSASAPSSCGLTNDGFSENVVALPVGIMTDADCGKTVTITYNGITKTATVVDKCMGCK
PTDLDASRHLFGELADFSAGRIDGMSWYFN