Allergen

L7UZ85.1

Accession L7UZ85.1
Species Dermatophagoides farinae
Common Name American house dust mite
Description Alpha-actinin; F-actin cross-linking protein; Der f 24.
IUIS Name
Gi
Length 885
Year Adopted 2018
Sequence >L7UZ85.1 Alpha-actinin; F-actin cross-linking protein; Der f 24 [Dermatophagoides farinae]
MTQDGYMQQEEEEWEREGLLDPAWEKQQRKTFTAWCNSHLRKAGTQIDNIEEDFRNGLKL
MLLLEVISGETLGKPDRGKMRFHKIANVNKALDFIESKGVKLVSIGAEEIVDGNSKMTLG
LIWTIILRFAIQDISVEEMTAKEGLLLWCQRKTAPYKNVNVQNFHLSWKDGLAFCALIHR
HRPDLIDYGKLRKDNPMDNFNLAFDVAEKHLNIPRMLDAEDVVYTAKPDERAIMTYVSWY
YHAFHGAQQAETAANRICKVLKVNQDNERLMEEYERLASDLLEWIRRTTPWLENRTTDNT
LPGTQKKLEEFRSYRRQHKPPRVEQKANLETNFNTLQTKLRLSKRPAYMPSEGKMVSDIT
GAWKGLESAEKGFEEWLLSEMMRLERLDHLAQKFKHKADIHEEWTQGKEEMLVSHDFRQC
KLNEIKALKKKHEAFESDLAAHQDRVEQIAAIAQELNALGYHDIASINARCQRICDQWDR
LGTLTTRRRQALDEAEQILEKVDLFHLEFAKRAAPFNNWLDETREDLVDMFIVHSIEEIQ
QLIDAHESFKNTLGEADKEYKTIVGLAQEVQPMATQYQIPGGLENPYTTLTPEVITTKWR
DVKQLVPQRDHTLQTELIRQQCNENLRRQFAEKANVVGPWIERQMDAVTAIGMGMQGTLE
DQLQRLHEYDQAVVQYRPHVDDLEKIHQEVQEAMIFENRYTQYTMETLRVGWEQLLTSIH
RNINEVENQILTRDSKGITQEQLNEFRTSFNHFDKKRTGRLAPEEFKSCLVSLGYNIRND
DRPEFRRILAIVDPNKTGYVHFDAFLDFMTREYTDTDTAEQMIDSFRILAGDKPYITADE
LRRELPPDQAEYCIRRMTPYNGQCAVPGALDYRSFSTALYGESDL
Parent Accession