Powered by FoodRisk.org

Allergen

NP_001036878.1

Accession NP_001036878.1
Species Bombyx mori
Common Name Silk Worm
Description 27 kDa glycoprotein precursor
Gi
Length 227
Year Adopted 2018
Sequence >accession|NP_001036878.1|27 kDa glycoprotein precursor [Bombyx mori]
MMWKTVLITIFAAGVLADDFSQITAVVTSQCTKNNAEDKVPEVEAALRTFGNCLKGLVDL
NVLKTEIEEAKPNGALDEVFKKYCDKSAQLKGCISSVLQGVRPCVGNEYANHINDAQNST
NQLIDFVCYKDGDRIALFIAEGGPECFQQKTENLKTCFLNLKQSFPTVESANNLSLVEKC
AKVDEMTSCIVKSLEECSTPTPANMAESLIKFMRKDSPCHTALPKTD