Allergen

NP_001103782.1

Accession NP_001103782.1
Species Bombyx mori
Common Name silkworm
Description tropomyosin
IUIS Name Bomb m 3
Gi
Length 285
Year Adopted 2022
Sequence >NP_001103782.1 Allergen Bomb m 3; tropomyosin [Bombyx mori]
MDAIKKKMQAMKLEKDNALDRAAMCEQQAKDANLRAEKAEEEARQLQKKIQTIENELDQT
QESLMQVNGKLEEKEKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLSEASQAA
DESERARKVLENRSLADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAE
ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAE
FAERSVQKLQKEVDRLEDELVAEKEKYKDIGDDLDTAFVELILKE
Parent Accession