Powered by FoodRisk.org

Allergen

NP_001238443.1

Accession NP_001238443.1
Species Glycine max
Common Name Soybean
Description 2S albumin precursor [Glycine max]
Gi 0351727517
Length 158
Year Adopted 2015
Sequence >accession|NP_001238443.1|Putative 2S albumin precursor [Glycine max]
MTKFTILLISLLFCIAHTCSASKWQHQQDSCRKQLQGVNLTPCEKHIMEKIQGRGDDDDD
DDDDNHILRTMRGRINYIRRNEGKDEDEEEEGHMQKCCTEMSELRSPKCQCKALQKIMEN
QSEELEEKQKKKMEKELINLATMCRFGPMIQCDLSSDD