Powered by FoodRisk.org

Allergen

O22116

Accession O22116
Species Triticum aestivum
Common Name Wheat
Description LMM glutenin 3
Gi 0075317968
Length 373
Year Adopted 2007
Sequence >accession|O22116|Putative LMM glutenin 3 [Triticum aestivum]
ASAVAQISQQQQPPPFSQQQQPPFSQQQQPPFSQQQQSPFSQQQQQPPFSQQQQPPFSQQ
PLISQQQQLPFSQQQQPQFSQQQQPPYSQQQQPPYSQQQQPPFSQQQQPPFSQQQQPSFS
QQQQQPPFTQQQQPPFSQQSPISQQQQQQQQQQQQPFTQQQQPPFSQQPPISQQQQPPFS
QQQQPPFSQQQQIPVIHPSVLQQLNPCMVFLQQQCIPVAMQRCLARSQMLQQSICHVMQR
QCCQQLRQIPEQSRHESIRAIIYSIILQQQQQQQQQQQQQQGQSIIQYQQQPPQQLGQCV
SQPQQQLQQQLGQQPQQQQLAHGTFLQPHKIAQLEVMTSIALRTLPRMCSVNVPLYETTT
SVPLGVGIGVGVY