Allergen

O23791.1

Accession O23791.1
Species Ananas comosus
Common Name Pineapple
Description bromelain, sulfhydryl protease
IUIS Name Ana c 2
Gi 0075277440
Length 351
Year Adopted 2007
Sequence >O23791.1 Allergen Ana c 2; bromelain, sulfhydryl protease [Ananas comosus]
MASKVQLVFLFLFLCAMWASPSAASRDEPNDPMMKRFEEWMAEYGRVYKDDDEKMRRFQI
FKNNVKHIETFNSRNENSYTLGINQFTDMTKSEFVAQYTGVSLPLNIEREPVVSFDDVNI
SAVPQSIDWRDYGAVNEVKNQNPCGSCWSFAAIATVEGIYKIKTGYLVSLSEQEVLDCAV
SYGCKGGWVNKAYDFIISNNGVTTEENYPYLAYQGTCNANSFPNSAYITGYSYVRRNDER
SMMYAVSNQPIAALIDASENFQYYNGGVFSGPCGTSLNHAITIIGYGQDSSGTKYWIVRN
SWGSSWGEGGYVRMARGVSSSSGVCGIAMAPLFPTLQSGANAEVIKMVSET
Parent Accession