Powered by FoodRisk.org

Allergen

O23791.1

Accession O23791.1
Species Ananas comosus
Common Name Pineapple
Description Bromelain precursor (Allergen Ana c 2)
IUIS Name
Gi 0075277440
Length 351
Year Adopted 2007
Sequence >O23791.1 Allergen Bromelain precursor (Allergen Ana c 2) [Ananas comosus]
MASKVQLVFLFLFLCAMWASPSAASRDEPNDPMMKRFEEWMAEYGRVYKDDDEKMRRFQI
FKNNVKHIETFNSRNENSYTLGINQFTDMTKSEFVAQYTGVSLPLNIEREPVVSFDDVNI
SAVPQSIDWRDYGAVNEVKNQNPCGSCWSFAAIATVEGIYKIKTGYLVSLSEQEVLDCAV
SYGCKGGWVNKAYDFIISNNGVTTEENYPYLAYQGTCNANSFPNSAYITGYSYVRRNDER
SMMYAVSNQPIAALIDASENFQYYNGGVFSGPCGTSLNHAITIIGYGQDSSGTKYWIVRN
SWGSSWGEGGYVRMARGVSSSSGVCGIAMAPLFPTLQSGANAEVIKMVSET
Parent Accession