Powered by FoodRisk.org

Allergen

O23878.1

Accession O23878.1
Species Fagopyrum esculentum
Common Name Buckwheat
Description 13S globulin seed storage protein 1 precursor (Legumin-like protein 1) [Contains: 13S globulin seed storage protein 1 acidic chain; 13S globulin seed storage protein 1 basic chain]
Gi 0029839254
Length 565
Year Adopted 2009
Sequence >accession|O23878.1|Putative 13S globulin seed storage protein 1 precursor (Legumin-like protein 1) [Fagopyrum esculentum]
MSTKLILSFSLCLMVLSCSAQLLPWRKGQRSRPHRGHQQFHHQCDVQRLTASEPSRRVRS
EAGVTEIWDNDTPEFRCAGFVAVRVVIQPGGLLLPSYSNAPYITFVEQGRGVQGVVVPGC
PETFQSESEFEYPQSQRDQRSRQSESEESSRGDQRTRQSESEEFSRGDQRTRQSESEEFS
RGDQRTRQSESEEFSRGDQRTRQSESEEFSRGDQHQKIFRIRDGDVIPSPAGVVQWTHND
GDNDLISITLYDANSFQNQLDGNVRNFFLAGQSKQSREDRRSQRQTREEGSDRQSRESDD
DEALLEANILTGFQDEILQEIFRNVDQETISKLRGDNDQRGFIVQARDLKLRVPEEYEEE
LQRERGDRKRGGSGRSNGLEQAFCNLKFKQNVNRPSRADVFNPRAGRINTVNSNNLPILE
FIQLSAQHVVLYKNAILGPRWNLNAHSALYVTRGEGRVQVVGDEGRSVFDDNVQRGQILV
VPQGFAVVLKAGREGLEWVELKNDDNAITSPIAGKTSVLRAIPVEVLANSYDISTKEAFR
LKNGRQEVEVFLPFQSRDEKERERF