Allergen

O23880.1

Accession O23880.1
Species Fagopyrum esculentum
Common Name Buckwheat
Description 13S globulin seed storage protein 2 precursor (Legumin-like protein 2) [Contains: 13S globulin seed storage protein 2 acidic chain; 13S globulin seed storage protein 2 basic chain]
IUIS Name
Gi 0029839255
Length 504
Year Adopted 2009
Sequence >O23880.1 Putative 13S globulin seed storage protein 2 precursor (Legumin-like protein 2) [Fagopyrum esculentum]
MSTKLILSFSLCLMVLSCSAQLWPWQKGQGSRPHHGRQQHQFQHQCDIQRLTASEPSRRV
RSEAGVTEIWDHDTPEFRCTGFVAVRVVIQPGGLLLPSYSNAPYITFVEQGRGVQGVVIP
GCPETFQSDSEFEYPQSQRGRHSRQSESEEESSRGDQHQKIFRIREGDVIPSPAGVVQWT
HNDGNDDLISVTLLDANSYHKQLDENVRSFFLAGQSQRETREEGSDRQSRESDDDEALLG
ANILSGFQDEILHELFRDVDRETISKLRGENDQRGFIVQAQDLKLRVPQDFEEEYERERG
DRRRGQGGSGRSNGVEQGFCNLKFRRNFNTPTNTYVFNPRAGRINTVNSNSLPILEFLQL
SAQHVVLYKNAIIGPRWNLNAHSALYVTRGEGRVQVVGDEGKSVFDDKVQRGQILVVPQG
FAVVLKAGREGLEWVELKNSGNAITSPIGGRTSVLRAIPVEVLANSYDISTKEAYKLKNG
RQEVEVFRPFQSRDEKERERFSIV
Parent Accession