Powered by FoodRisk.org

Allergen

P00785.4

Accession P00785.4
Species Actinidia chinensis
Common Name Kiwi
Description RecName: Full=Actinidain; Short=Actinidin; AltName: Allergen=Act c 1; Flags: Precursor
Gi 0190358935
Length 380
Year Adopted 2009
Sequence >accession|P00785.4|Allergen RecName: Full=Actinidain; Short=Actinidin; AltName: Allergen=Act c 1; Flags: Precursor [Actinidia chinensis]
MGLPKSFVSMSLLFFSTLLILSLAFNAKNLTQRTNDEVKAMYESWLIKYGKSYNSLGEWE
RRFEIFKETLRFIDEHNADTNRSYKVGLNQFADLTDEEFRSTYLRFTSGSNKTKVSNRYE
PRVGQVLPSYVDWRSAGAVVDIKSQGECGGCWAFSAIATVEGINKIVTGVLISLSEQELI
DCGRTQNTRGCNGGYITDGFQFIINNGGINTEENYPYTAQDGECNVDLQNEKYVTIDTYE
NVPYNNEWALQTAVTYQPVSVALDAAGDAFKQYSSGIFTGPCGTAVDHAVTIVGYGTEGG
IDYWIVKNSWDTTWGEEGYMRILRNVGGAGTCGIATMPSYPVKYNNQNHPKPYSSLINPP
AFSMSKDGPVGVDDGQRYSA