Powered by FoodRisk.org

Allergen

P00785.4

Accession P00785.4
Species Actinidia chinensis
Common Name Kiwi
Description cysteine protease, actinidin
IUIS Name Act c 1
Gi 0190358935
Length 380
Year Adopted 2009
Sequence >P00785.4 Allergen Act c 1; cysteine protease, actinidin [Actinidia chinensis]
MGLPKSFVSMSLLFFSTLLILSLAFNAKNLTQRTNDEVKAMYESWLIKYGKSYNSLGEWE
RRFEIFKETLRFIDEHNADTNRSYKVGLNQFADLTDEEFRSTYLRFTSGSNKTKVSNRYE
PRVGQVLPSYVDWRSAGAVVDIKSQGECGGCWAFSAIATVEGINKIVTGVLISLSEQELI
DCGRTQNTRGCNGGYITDGFQFIINNGGINTEENYPYTAQDGECNVDLQNEKYVTIDTYE
NVPYNNEWALQTAVTYQPVSVALDAAGDAFKQYSSGIFTGPCGTAVDHAVTIVGYGTEGG
IDYWIVKNSWDTTWGEEGYMRILRNVGGAGTCGIATMPSYPVKYNNQNHPKPYSSLINPP
AFSMSKDGPVGVDDGQRYSA
Parent Accession