Powered by FoodRisk.org

Allergen

P02604.3

Accession P02604.3
Species Gallus gallus
Common Name Chicken
Description RecName: Full=Myosin light chain 1, skeletal muscle isoform; AltName: Full=Alkali myosin light chain 1; Short=MLC-1; AltName: Full=Myosin light chain 1f; AltName: Full=Myosin light chain alkali 1; Short=Myosin light chain A1; AltName: Full=Skeletal-muscle
Gi 0055584149
Length 192
Year Adopted 2016
Sequence >accession|P02604.3|Putative RecName: Full=Myosin light chain 1, skeletal muscle isoform; AltName: Full=Alkali myosin light chain 1; Short=MLC-1; AltName: Full=Myosin light chain 1f; AltName: Full=Myosin light chain alkali 1; Short=Myosin light chain A1; AltName: Full=Skeletal-muscle [Gallus gallus]
MAPKKDVKKPAAAAAPAPAPAPAPAPAPAKPKEPAIDLKSIKIEFSKEQQDDFKEAFLLF
DRTGDAKITLSQVGDIVRALGQNPTNAEINKILGNPSKEEMNAKKITFEEFLPMLQAAAN
NKDQGTFEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMTEEEVEELMKGQEDSNGCI
NYEAFVKHIMSV