Allergen

P02878.1

Accession P02878.1
External DB Link NCBI Protein
Species Ambrosia artemisiifolia
Common Name short ragweed
Description unknown function
IUIS Name Amb a 5
Length 45
Year Adopted 2007
Sequence >P02878.1 Amb a 5; unknown function [Ambrosia artemisiifolia]
LVPCAWAGNVCGEKRAYCCSDPGRYCPWQVVCYESSEICSKKCGK
Parent Accession

Related Articles

Pubmed Authors Title Journal
7511632 Ghosh,B.; Rafnar,T.; Perry,M.P.; Bassolino-Klimas,D.; Metzler,W.J.; Klapper,D.G.; Marsh,D.G. Immunologic and molecular characterization of Amb p V allergens from Ambrosia psilostachya (western Ragweed) pollen J. Immunol. 152 (6), 2882-2889 (1994)
1122277 Mole,L.E.; Goodfriend,L.; Lapkoff,C.B.; Kehoe,J.M.; Capra,J.D. The amino acid sequence of ragweed pollen allergen Ra5 Biochemistry 14 (6), 1216-1220 (1975)
4685040 Marsh DG; Bias WB; Hsu SH; Goodfriend L Association of the HL-A7 cross-reacting group with a specific reaginic antibody response in allergic man. Science. 1973 Feb 16;179(74):691-3