Allergen

P0C0Y4.2

Accession P0C0Y4.2
Species Alternaria alternata
Common Name Fungus
Description mannitol dehydrogenase
IUIS Name Alt a 8
Gi 0118595439
Length 266
Year Adopted 2008
Sequence >P0C0Y4.2 Allergen Alt a 8; mannitol dehydrogenase [Alternaria alternata]
MPISVPQATELKDLFSLKGKVVIVTGASGPTGIGTEAARGCAEYGADLAITYNSRAEGAE
KNAKEMSEKYGVKVKAYKCQVNEYAQCEKLVQDVIKDFGKVDVFIANAGKTADNGILDAT
VEQWNEVIQTDLTGTFNCARAVGLHFRERKTGSLVITSSMSGHIANFPQEQASYNVAKAG
CIHLAKSLANEWRDFARVNSISPGYIDTGLSDFVPQDIQKLWHSMIPMGRDAKATELKGA
YVYFASDASSYCTGSDLLIDGGYCVR
Parent Accession