Allergen

P0C1Y5.1

Accession P0C1Y5.1
Species Zea mays
Common Name Corn
Description Expansin-B11 precursor (ZmEXPB11) (Beta-expansin-11) (Pollen allergen Zea m 1a) (Pollen allergen Zea m 1b)
IUIS Name
Gi 0115502168
Length 269
Year Adopted 2009
Sequence >P0C1Y5.1 Putative Expansin-B11 precursor (ZmEXPB11) (Beta-expansin-11) (Pollen allergen Zea m 1a) (Pollen allergen Zea m 1b) [Zea mays]
MTVVSIMWSLVQVQVLVAVALAFLVGGAWCGPPKVPPGKNITAKYGSDWLDAKATWYGKP
TGAGPDDNGGGCGYKDVNKAPFNSMGACGNVPIFKDGLGCGSCFEIKCDKPAECSGKPVV
VYITDMNYEPIAAYHFDLAGTAFGAMAKKGEEEKLRKAGIIDMQFRRVKCKYGSKVTFHL
EKGCNPNYLALLVKYVDGDGDIVAVDIKEKGSDTYEPLKHSWGAIWRKDSDKPIKGPITV
QLTTEGGTKTVYDDVIPAGWKPNTAYTAK
Parent Accession