Allergen

P10414.2

Accession P10414.2
External DB Link NCBI Protein
Species Ambrosia trifida
Common Name giant ragweed
Description unknown function
IUIS Name Amb t 5
Length 73
Year Adopted 2007
Sequence >P10414.2 Amb t 5; unknown function [Ambrosia trifida]
MKNIFMLTLFILIITSTIKAIGSTNEVDEIKQEDDGLCYEGTNCGKVGKYCCSPIGKYCV
CYDSKAICNKNCT
Parent Accession

Related Articles

Pubmed Authors Title Journal
1711499 Ghosh,B.; Perry,M.P.; Marsh,D.G. Cloning the cDNA encoding the AmbtV allergen from giant ragweed (Ambrosia trifida) pollen Gene 101 (2), 231-238 (1991)
3862954 Goodfriend,L.; Choudhury,A.M.; Klapper,D.G.; Coulter,K.M.; Dorval,G.; Del Carpio,J.; Osterland,C.K. Ra5G, a homologue of Ra5 in giant ragweed pollen: isolation, HLA-DR-associated activity and amino acid sequence Mol. Immunol. 22 (8), 899-906 (1985)
3856613 Roebber M; Klapper DG; Goodfriend L; Bias WB; Hsu SH; Marsh DG Immunochemical and genetic studies of Amb.t. V (Ra5G), an Ra5 homologue from giant ragweed pollen. J Immunol. 1985 May;134(5):3062-9
16275372 Asero R; Weber B; Mistrello G; Amato S; Madonini E; Cromwell O Giant ragweed specific immunotherapy is not effective in a proportion of patients sensitized to short ragweed: analysis of the allergenic differences between short and giant ragweed. J Allergy Clin Immunol. 2005 Nov;116(5):1036-41