Powered by FoodRisk.org

Allergen

P11376

Accession P11376
Species Equus caballus
Common Name horse
Description Allergen Equ c 6.01; lysozyme C, milk isozyme
IUIS Name
Gi
Length 129
Year Adopted 2020H_MS
Sequence >P11376 Allergen Equ c 6.01; lysozyme C, milk isozyme [Equus caballus]
KVFSKCELAHKLKAQEMDGFGGYSLANWVCMAEYESNFNTRAFNGKNANGSSDYGLFQLN
NKWWCKDNKRSSSNACNIMCSKLLDENIDDDISCAKRVVRDPKGMSAWKAWVKHCKDKDL
SEYLASCNL
Parent Accession