Allergen

P29022

Accession P29022
Species Zea mays
Common Name Maize
Description chitinase
IUIS Name Zea m 8
Gi
Length 280
Year Adopted 2018
Sequence >P29022.1 Endochitinase A; Seed chitinase A [Zea mays]
MANAPRILALGLLALLCAAAGPAAAQNCGCQPNFCCSKFGYCGTTDAYCGDGCQSGPCRS
GGGGGGGGGGGGGGSGGANVANVVTDAFFNGIKNQAGSGCEGKNFYTRSAFLSAVNAYPG
FAHGGTEVEGKREIAAFFAHVTHETGHFCYISEINKSNAYCDASNRQWPCAAGQKYYGRG
PLQISWNYNYGPAGRDIGFNGLADPNRVAQDAVIAFKTALWFWMNNVHGVMPQGFGATIR
AINGALECNGNNPAQMNARVGYYKQYCQQLRVDPGPNLIC
Parent Accession