Allergen

P42037.1

Accession P42037.1
Species Alternaria alternata
Common Name Fungus
Description acidic ribosomal protein P2
IUIS Name Alt a 5
Gi 0001173071
Length 113
Year Adopted 2010
Sequence >P42037.1 Allergen Alt a 5; acidic ribosomal protein P2 [Alternaria alternata]
MKHLAAYLLLGLGGNTSPSAADVKAVLESVGIEADSDRLDKLISELEGKDINELIASGSE
KLASVPSGGAGGAAASGGAAAAGGSAQAEAAPEAAKEEEKEESDEDMGFGLFD
Parent Accession