Allergen

P49148.1

Accession P49148.1
Species Alternaria alternata
Common Name Fungus
Description acidic ribosomal protein P1
IUIS Name Alt a 12
Gi 0001350779
Length 110
Year Adopted 2007
Sequence >P49148.1 Allergen Alt a 12; acidic ribosomal protein P1 [Alternaria alternata]
MSTSELATSYAALILADDGVDITADKLQSLIKAAKIEEVEPIWTTLFAKALEGKDVKDLL
LNVGSGGGAAPLPEALLLRWRAADAAPAAEEKKEEEKEESDEDMGFGLFD
Parent Accession