Allergen

P62927

Accession P62927
Species Pisum sativum
Common Name pea
Description 2S albumin, conglutin
IUIS Name
Gi
Length 130
Year Adopted 2022
Sequence >P62927 2S albumin, conglutin [Pisum sativum]
MASVKLASLMVLFATLGMFLTKNVGAASCNGVCSPFEMPPCGSSACRCIPVGLVVGYCRH
PSGVFLRTNDEHPNLCESDADCRKKGSGNFCGHYPNPDIEYGWCFASKSEAEDFFSKITQ
KDLLKSVSTA
Parent Accession