Allergen

P78983.2

Accession P78983.2
Species Alternaria alternata
Common Name Fungus
Description heat shock protein 70
IUIS Name Alt a 3
Gi 0014423730
Length 152
Year Adopted 2007
Sequence >P78983.2 Allergen Alt a 3; heat shock protein 70 [Alternaria alternata]
KTNKIVITNDKGRLSKEEIERMLAEAEKYKAEDEAEAARISAKNALESYAYSLRNTLSDS
KVDEKLDAGDKQKLTAEIDKTVQWLDDNQTATKDEYESQQKELEGVANPIMMKFYGAGGE
GGMPGGMPGGGMPGGAPGGAAGDDGPTVEEVD
Parent Accession