Powered by FoodRisk.org

Allergen

P80207.1

Accession P80207.1
Species Brassica juncea
Common Name Mustard
Description Allergen Bra j 1-E (Bra j I) [Contains: Allergen Bra j 1-E small chain; Allergen Bra j 1-E large chain]
Gi 0032363444
Length 129
Year Adopted 2009
Sequence >accession|P80207.1|Putative Allergen Bra j 1-E (Bra j I) [Contains: Allergen Bra j 1-E small chain; Allergen Bra j 1-E large chain] [Brassica juncea]
AGPFRFPRCRKEFQQAQHLRACQQWLHKQAMQSGSGPQPQGPQQRPPLLQQCCNELHQEE
PLCVCPTLKGASKAVKQQIRQQGQQQGQQGQQLQHEISRIYQTATHLPRVCNIPRVSICP
FQKTMPGPS