Allergen

P82977.2

Accession P82977.2
External DB Link NCBI Protein
Species Triticum aestivum
Common Name wheat
Description serine protease inhibitor
IUIS Name Tri a 39
Length 84
Year Adopted 2011
Sequence >P82977.2 Tri a 39; serine protease inhibitor [Triticum aestivum]
MSSVVKKPLGGNTDTGDHHNQKTEWPELVGKSVEEAKKVILQDKSEAQIVVLPVGTIVTM
EYRIDRVRLFVDSLDKIAQVPRVG
Parent Accession

Related Articles

Pubmed Authors Title Journal
18490745 Constantin,C.; Quirce,S.; Grote,M.; Touraev,A.; Swoboda,I.; Stoecklinger,A.; Mari,A.; Thalhamer,J.; Heberle-Bors,E.; Valenta,R.; Molecular and immunological characterization of a wheat serine proteinase inhibitor as a novel allergen in baker's asthma J. Immunol. 180 (11), 7451-7460 (2008)
19210348 Constantin C; Quirce S; Poorafshar M; Touraev A; Niggemann B; Mari A; Ebner C; Akerström H; Heberle-Bors E; Nystrand M; Valenta R Micro-arrayed wheat seed and grass pollen allergens for component-resolved diagnosis. Allergy. 2009 Jul;64(7):1030-7
21462797 Salcedo G; Quirce S; Diaz-Perales A Wheat allergens associated with Baker J Investig Allergol Clin Immunol. 2011;21(2):81-92; quiz 94
N/A: See Journal Sander I, Rihs H, Razynek P, Doekes G, Quirce S, van Kampen V, Bruning T, Raljf-Heimsoth M. Baker's asthma_frequence of specific IgE to recombinant wheat flour allergens in German, Dutch and Spanish Bakers Allergy 67, Suppl 96 2012 pg 74