Powered by FoodRisk.org

Allergen

P85206.1

Accession P85206.1
Species Actinidia deliciosa
Common Name Kiwi
Description RecName: Full=Non-specific lipid-transfer protein 2; Short=LTP2; AltName: Allergen=Act d 10.02
Gi 0378548411
Length 92
Year Adopted 2013
Sequence >accession|P85206.1|Allergen RecName: Full=Non-specific lipid-transfer protein 2; Short=LTP2; AltName: Allergen=Act d 10.02 [Actinidia deliciosa]
TVSCGQVDTALTPCLTYLTKGGTPSTQCCSGVRSLKSMTGTKVPDRQAACNCLKQAAARY
QGIKDAAAALSQKCGVQLSVPISRSTDCSKIS