Powered by FoodRisk.org

Allergen

P86137.2

Accession P86137.2
Species Actinidia deliciosa
Common Name Kiwi
Description RecName: Full=Non-specific lipid-transfer protein 1; Short=LTP1; Short=nsLTP1; AltName: Allergen=Act d 10.01
Gi 0378405189
Length 92
Year Adopted 2013
Sequence >accession|P86137.2|Allergen RecName: Full=Non-specific lipid-transfer protein 1; Short=LTP1; Short=nsLTP1; AltName: Allergen=Act d 10.01 [Actinidia deliciosa]
AVSCGQVDTALTPCLTYLTKGGTPSTQCCSGVRSLKSMTGTKVPDRQAACNCLKQAAARY
QGIKDAAAALSQKCGVQLSVPISRSTDCSKIS