Powered by FoodRisk.org

Allergen

P86686.1

Accession P86686.1
Species Polybia paulista
Common Name wasp
Description unknown/antigen 5
IUIS Name Poly p 5
Gi 0302595972
Length 207
Year Adopted 2012
Sequence >P86686.1 Allergen Poly p 5; unknown/antigen 5 [Polybia paulista]
NKYCNIKCSKVAHTVCQTGESTKPSSKNCAKVSITSVGVTEEEKKLIVDEHNRFRQKVAQ
GLETRGNPGPQPAASDMNNLVWNDELAYIAQVWASQCQFFVHDKCRNTAQYQVGQNIAYS
ASTAAYPGVVKLIVLWENEVKDFNYNTGITKENFAKVGHYTQVVWAKTKEVGCGSIKYIE
KGMKSHYLVCNYGPAGNVLGAQIYEIK
Parent Accession