Powered by FoodRisk.org

Allergen

P86687.1

Accession P86687.1
Species Polybia paulista
Common Name wasp
Description hyaluronidase
IUIS Name Poly p 2
Gi 0302425085
Length 288
Year Adopted 2012
Sequence >P86687.1 Allergen Poly p 2; hyaluronidase [Polybia paulista]
GETISIYYDPGKFPALMPLKNGNYEERNGGVPQRGNITIHLQQFNEDLDKMTPDKNFGGI
GVIDFERWKPIFRQNWGNTEIHKKYSIELVRYEHPKWSESMIEAEATKKFEKYARLFMEE
TLKLAKKTRKRAKWGYYGFPYCYNYTPNNPGPDCDAKAMIENDRLSWMYNNQEILFPSVY
VRHELTPDQRVYLVQGRIKEAVRISNNLKHSPKVLSYWWYVYQDKMDIFLSETDVKKTFQ
EIVTNGGDGIIIWGSSSDVNSLSKCKRLREYLLNTLGPFAVNVTETVN
Parent Accession